100 ug
33R-3240
280 EUR
Click to
buy
HSPA9 Blocking Peptide
on Gentaurs online shop
Proteins
Blocking Peptides
Protein Modification & Stress Response
GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ
Synthetic
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
WB, IHC
Blue Ice
You can block the antibody by the specific target amino acid sequence of peptide.
blocking peptide
Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.