1 mg
C251-1000
2283 EUR
Click to
buy
Recombinant Human Heat Shock Protein ß-11/HSPB11 (N-6His)
on Gentaurs online shop
Recombinant Human Heat Shock Protein beta-11 is produced by our E.coli expression system and the target gene encoding Met1-Ser144 is expressed with a 6His tag at the N-terminus.
Human
Escherichia coli
MGSSHHHHHHSSGLVPRGSHMRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
18,5 kDa
Greater than 95% as determined by reducing SDS-PAGE.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Dry ice/ice packs
Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 10% Glycerol, pH 8.0.
Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Q9Y547
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Recombinants or rec. proteins
recombinants
Click to
buy
Recombinant Human Heat Shock Protein ß-11/HSPB11 (N-6His)
on Gentaurs online shop