1 mg
C284-1000
2283 EUR
Click to
buy
Recombinant Human Heat Shock Factor Protein 2/HSF2 (N-6His)
on Gentaurs online shop
Recombinant Human Heat Shock Factor Protein-2 is produced by our E.coli expression system and the target gene encoding Ser411-Ser536 is expressed with a 6His tag at the N-terminus.
Human
Escherichia coli
MGSSHHHHHHSSGLVPRGSHMSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS
15,9 kDa
Greater than 95% as determined by reducing SDS-PAGE.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Ambient/Room Temperature
Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2.
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Q03933
Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Recombinants or rec. proteins
recombinants
Click to
buy
Recombinant Human Heat Shock Factor Protein 2/HSF2 (N-6His)
on Gentaurs online shop