Recombinant Human Heat Shock Protein ß-2//HSPB2/MKBP (C-6His)

Product information

  • Size

    500 ug

  • Catalog number

    CH63-500

  • Price

    710 EUR

Click to buy
Recombinant Human Heat Shock Protein ß-2//HSPB2/MKBP (C-6His)
on Gentaurs online shop

Product details

Description

Recombinant Human Heat shock protein beta-2 is produced by our E.coli expression system and the target gene encoding Met1-Pro182 is expressed with a 6His tag at the C-terminus.

Species reactivity

Human

Origin

Escherichia coli

Peptide sequence

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEPLEHHHHHH

Estimated molecular weight

21,3 kDa

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Shipping condition

Ambient/Room Temperature

Package form

Lyophilized from a 0.2 µm filtered solution of 20mM HEPES,0.1MKCl,pH7.5.

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Reconstitution conditions

See included datasheet or contact us for more information.

UniProt number

Q16082

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Source

Recombinants or rec. proteins

Group

recombinants

Click to buy
Recombinant Human Heat Shock Protein ß-2//HSPB2/MKBP (C-6His)
on Gentaurs online shop