10 ug
CH63-10
101 EUR
Click to
buy
Recombinant Human Heat Shock Protein ß-2//HSPB2/MKBP (C-6His)
on Gentaurs online shop
Recombinant Human Heat shock protein beta-2 is produced by our E.coli expression system and the target gene encoding Met1-Pro182 is expressed with a 6His tag at the C-terminus.
Human
Escherichia coli
MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEPLEHHHHHH
21,3 kDa
Greater than 95% as determined by reducing SDS-PAGE.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Ambient/Room Temperature
Lyophilized from a 0.2 µm filtered solution of 20mM HEPES,0.1MKCl,pH7.5.
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
See included datasheet or contact us for more information.
Q16082
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Recombinants or rec. proteins
recombinants
Click to
buy
Recombinant Human Heat Shock Protein ß-2//HSPB2/MKBP (C-6His)
on Gentaurs online shop